We can't use the nitrogen present in the atmosphere although 80% of the atmosphere consists of nitrogen only.We get this from the plants called as leguminous plants which can convert or fix atmospheric nitrogen into usable ones..
Activation energy is the minimum amount of energy that the colliding reactant molecules must possess for the formation of products. Lower the activation energy, higher will be chance of formation of products. So activation energy is the minimum energy requirement that has to overcome for the reaction to be completed. Therefore, when in a chemical reaction the reactant molecules do not collide with required activation energy, the collisions will not be fruitful even if they are properly oriented which means that the products will not form.
Hence the correct answer will be B.) no products will be formed
Answer:
384.2 K
Explanation:
First we convert 27 °C to K:
- 27 °C + 273.16 = 300.16 K
With the absolute temperature we can use <em>Charles' law </em>to solve this problem. This law states that at constant pressure:
Where in this case:
We input the data:
300.16 K * 1600 m³ = T₂ * 1250 m³
And solve for T₂:
T₂ = 384.2 K
Answer:
Look at the picture.
Explanation:
On stage one binding of a substrate occurs (and also the geometry of active site may change) and water comes to the site. On stage two the hydrolisis takes place and on stage 3 products deabsorb from the enzyme.
Answer:
i dont no ehh ahh i answer this question and this question is an dibitual sence
Explanation:
ahahalsbaowvapnavskqleveywpwndvsmavalsnsbalsmbsiabsopqmgdijsbsiwbskwnvskabhsksn
mabahslambbsoalnqnmlpigfqjskbdnmxnxb slabslwobdksjwmsnmaksbkakskslanksoqlmmbsjpqloyewqasfhjllmvxxwtyipeorirubamsbsmsnsmsoandbaksnsgaks
