1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Xelga [282]
3 years ago
14

Please help I am struggling

Mathematics
1 answer:
likoan [24]3 years ago
4 0

☆ The relation between x and y is <u>y</u><u> </u><u>=</u><u> </u><u>a</u><u> </u><u>cos</u><u> </u><u>x°</u><u> </u><u>+</u><u>b</u><u> </u>

Taking 1st condition from the table .

→ x = 0 and y = 9

→ y = a + cos 0° + b

→ 9 = a + cos 0° + b

☆ We know that cos 0° = 1

→ 9 = a(1) + b

<h3>→ a + b = 9. equation 1st </h3>

Now taking other condition

→ x = 90° and y = 1

→ y = a cos 90° + b

→ 1 = a cos 90° + b

☆ We know that cos 90° is 0

→ 1 = a(0) + b

<h3>→ 1 = b </h3>

<u>Putt</u><u>ing</u><u> the</u><u> </u><u>val</u><u>ue</u><u> of</u><u> </u><u>b</u><u> </u><u>in</u><u> </u><u>equation</u><u> </u><u>1</u><u>s</u><u>t</u><u> </u><u>.</u><u> </u>

→ 9 = a + 1

→ <u>a</u><u> </u><u>=</u><u> </u><u>8</u><u> </u><u>.</u><u> </u>

<u>Now</u><u> </u><u>taki</u><u>ng</u><u> the</u><u> </u><u>value</u><u> </u><u>of</u><u> </u><u>x</u><u> </u><u>acc</u><u>ording</u><u> to</u><u> the</u><u> </u><u>ques</u><u>tion</u><u> </u><u>.</u>

☆ x = 45 °

→ y = 8 ( cos 45°) + 1

☆ We know that cos 45° is 1/√2

→ y = 8(1/√2) + 1

→ 8 = 4×√2×√2

<h3>y = 4√2 +1 </h3>

So the answer is <u>4</u><u>√</u><u>2</u><u>+</u><u>1</u><u> </u>

You might be interested in
Choose the system of equations which matches the following graph:
aleksandr82 [10.1K]
The coordinates give are
(0,6)
(4,9)

(3,6)
(2,3)

These points can be substituted into the systems of equation in the choices and inspect which equations satisfy the value of the points. Doing this, the answer is
3x - 4y = -24
3x - y = 3
4 0
3 years ago
Need Help ASAP). □ ABC is transformed to □ DBE. I posted a picture of the design and questions A, B, and question C. ( Will Mark
salantis [7]

Answer:

A)A reflection can be used to create DBE

B)The Angles are congruent, as the transformation was rigid, which preserves angle measure and side length.

C)All the angles are corresponding to the second figure as well as the sides. (name all the sides and angles that are corresponding)

Ex: ABC=DBE

Hope this helps!

P.S. Stay Safe!

-Andrew-OUT!

3 0
3 years ago
Read 2 more answers
What is the length of the missing leg?*<br> 60 cm<br> 36 cm<br><br> B=?
OverLord2011 [107]

Answer:

i think the leg is 60 cm

Step-by-step explanation:

sana po makatulong

8 0
3 years ago
Read 2 more answers
9876543210 number name in international system​
vfiekz [6]
What exactly are you asking?
What’s the question?
7 0
3 years ago
Write a linear equation representing a line parallel to y axis and is at a distance 3 units on the right side of y axis
arsen [322]

Answer:

hmmmm

Step-by-step explanation:

Oki y 123

x134 osiowownwhwowoeuejjensvpnevpjphpgnnqgpfnwcnpnspsvnpwnpnwpnepvnpenpqkvkvkdvke level oxbqlcnwodbwdpnqdonwpdnwfnwpnw0fj20rj10i1045882852585i205725

6 0
3 years ago
Other questions:
  • Find the approximate perimeter of rectangle FOUR plotted below.
    9·1 answer
  • 4 - 6x &lt; 2(2x + 3)<br> Cómo resolver esta ecuación ?
    13·1 answer
  • What is the domain for math?
    14·2 answers
  • You earn $1 million per month. What is your annual salary
    14·2 answers
  • 45 for 12 gallons of gas how much did each gallon of gas cost
    12·2 answers
  • For each of these sequences below: (a) describe the term-to-term rule (b) calculate the tenth term 4.1) 3 6 9 12 15 4.2) 5 11 17
    13·1 answer
  • 6th Grade Math
    11·2 answers
  • Ryan biked from home to school in <img src="https://tex.z-dn.net/?f=%5Cfrac%7B1%7D%7B5%7D" id="TexFormula1" title="\frac{1}{5}"
    8·2 answers
  • Carla and four of her friends went to the movie theater and found that there were only five seats left in the theater. How many
    13·2 answers
  • Translate this phrase into an algebraic expression.
    14·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!