Answer:
680
Explanation:
When the P680 special pair of photosystem II absorbs energy, it enters an excited (high-energy) state. Excited P680 is a good electron donor and can transfer its excited electron to the primary electron acceptor, pheophytin.
Metabolizing nitrogen in prokaryotes is very important to other organisms since these prokaryotes are able to convert ammonium in the soil to nitrate and, then, the denitrifying bacteria could use the nitrate produced instead of using oxygen in their metabolism in order to release nitrogen molecules. by the denitrification process, thus completing the nitrogen cycle. Without the nitrogen metabolism in prokaryotes, the nitrogen in the atmosphere could not be used or utilized to synthesize essential organic compounds that are needed by other organisms. It is only the prokaryotes that has the ability fixing nitrogen or can do the process of nitrogen fixation.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
The characteristics that define liver diseases within bryophytes are:
They are terrestrial plants unlike Charophytes that are aquatic.
There is development of an embryo that gives rise to a diploid multicellular sporophyte.
