1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
attashe74 [19]
3 years ago
7

Is 9.37 greater or less than 5.999?

Mathematics
1 answer:
Zarrin [17]3 years ago
7 0

Answer: 9.37 is greater than 5.999.

Step-by-step explanation: Look at the whole number. It's 9 and 5. 9nis greater than 5, therefore it's greater.

You might be interested in
An urn contains 3 red and 7 black balls. Players A and B take turns (A goes first) withdrawing balls from the urn consecutively.
andrey2020 [161]

Answer:

The probability that A selects the first red ball is 0.5833.

Step-by-step explanation:

Given : An urn contains 3 red and 7 black balls. Players A and B take turns (A goes first) withdrawing balls from the urn consecutively.

To find : What is the probability that A selects the first red ball?

Solution :

A wins if the first red ball is drawn 1st,3rd,5th or 7th.

A red ball drawn first, there are E(1)= ^9C_2 places in which the other 2 red balls can be placed.

A red ball drawn third, there are E(3)= ^7C_2 places in which the other 2 red balls can be placed.

A red ball drawn fifth, there are E(5)= ^5C_2 places in which the other 2 red balls can be placed.

A red ball drawn seventh, there are E(7)= ^3C_2 places in which the other 2 red balls can be placed.

The total number of total event is S= ^{10}C_3

The probability that A selects the first red ball is

P(A \text{wins})=\frac{(^9C_2)+(^7C_2)+(^5C_2)+(^3C_2)}{^{10}C_3}

P(A \text{wins})=\frac{36+21+10+3}{120}

P(A \text{wins})=\frac{70}{120}

P(A \text{wins})=0.5833

6 0
3 years ago
Persons younger than 18 years old are not eligible to vote. Let a be age in years.
Usimov [2.4K]
Younger than = less than

Less than symbol = <

People cannot have a negative age, so a must be positive

B. <span>a < 18 and a must be a positive number</span>
8 0
3 years ago
Jorge ordered 22 bottles of juice. Each bottle holds 6.32 ounces of juice.
Umnica [9.8K]

Answer: On the first one its either A or D. (I think)

Step-by-step explanation:

So what I did was I multiplied 22 and 6.32 together and got 139.04 and the closest estimate to that would be 160 because 39 is closer to 60 than 20 (A) and since its not 150 the estimate would be lower than higher. (D)

4 0
3 years ago
Read 2 more answers
Find the ninth term of the sequence sqrt 5, sqrt 10, ^2sqrt 5
hjlf
The rule of geometric sequence is   ⇒⇒⇒ a * r^(n-1)
Where a is the first term and  r is the common ratio
for the given sequence  √5 , √10 , 2√5 , .......
a = √5
r = √10 / √5 = √2
The ninth term = √5 * (√2)^(9-1) = √5 * (√2)⁸ = 16 √5

the correct answer is the third option 16√5
5 0
3 years ago
Given g(x)=5x+2, find g(-6)
kkurt [141]
Bcfvn. BBC bmbbc. B b vhjvchxcj church. Hvhvychbycycbffjctccycycvidycgdfrghfdhfhfhfgkepfgogigugbhvgvyvjvufbinibunobinib k hvugycvbjjvuvcubjch gju furyfucfyfjcufrdifjfcjj
7 0
3 years ago
Read 2 more answers
Other questions:
  • Are the two triangles similar? If so, state the reason and the similarity statement.
    10·2 answers
  • How to add one digit number to 19. Write a sentence to explain
    12·1 answer
  • You want to know how many calories you burn when you exercise. Look at the calories / exercise table below.
    11·1 answer
  • I need help?!!<br> Answer quicklyy
    6·1 answer
  • 1/9(8 1/3(21x-51y)1x-108y+2x^2)
    9·1 answer
  • What is 366 divided by 61
    15·2 answers
  • Solve for x:<br> (5x + 9)<br> (8x - 30)
    10·1 answer
  • Jesse went out for a 4-course meal were he had a choice of 3 salads, 3 appetizers, 4 entrees, and 5 desserts. How many different
    14·1 answer
  • Claudia studied for 45 minutes. Crystal studied for 5 minutes.
    7·1 answer
  • Can someone help me with math I need help I will attempt to give y’all help too!
    15·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!