Answer and Explanation:
In homeostatic control processes any deviation from the norm sets into motion the appropriate corrective mechanisms which restore the norm. This rectification occurs through negative feedback. When you go outside wearing a sweater on a hot day, the body sends messages to the CNS and the following occurs:
- The superficial blood vessels vasodilate so that more blood flows near the surface. This encourages heat loss.
- Sweating and panting. Sweat secreted by the sweat glands evaporate from the surface of the body as it absorbs latent heat.
- The metabolic rate falls so that the body generates less heat. You also become less active
- Behavioural response by seeking cooler areas, cold drinks or removal of the sweater.
Answer:
"You have to believe the exercise works before you try it" would be the pseudoscientific claim.
I don’t know the answer to this question
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
The correct answer is - leads.
Explanation:
In ECG or electrocardiogram, a test that is used to measure the electric activity of the heart of an individual, each electric impulse cause a electric wave to travel through the heart and cause the heart pump to pump blood.
There are electrodes that received the electric impulse in this machines, electrodes have self adhesive pads and attached with various leads mostly 12, that carries the impulses in the combinations that are recorded on the ECG.
Thus, the correct answer is - leads.
