Answer:
Please see below
Explanation:
Adapting to the surrounding environment is a critical part of surviving and, eventually, evolution. Take mice as an instance. Their coat color plays a major role in allowing to go undetected from potential predators if they are able to blend in well with the surrounding environment. Mice with a coat color that makes them stand out will be easily preyed on. Hence, those who have <u><em>adapted</em></u> to their environmental conditions will live to pass on their genes. This phenomenon is known as selection pressure.
Movement of water through a plasma membrane from a low to high solute concentration.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
