What this student is doing is collecting data. So, he wants to check how many life forms there are in the waters nearby. In order to do so, he has to take a sample, and look at it through a microscope so as to determine the number. So, he collected a sample which is his data. He is not drawing conclusions yet, but rather counting these organisms. He is not making a peer review - his peers aren't even mentioned here. He is not forming a hypothesis because he is just counting at this point.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
The correct answer is option B) "computers are not as trustworthy as actual prototypes are"
Explanation:
It is false to affirm that results obtained from computer simulations towards looking for solutions of real-world problems are not as trustworthy as results obtained from actual prototypes. In most cases, computer simulations had proved to be reliable, particularly when the programers use validating arithmetic and algorithms. There are multiple companies dedicated to develop computer simulations to solve real-world problems, which are constantly used and tested in scientific investigations.
The correct answer is ... B) a nucleus. DNA is found, tightly coiled in chromosomes in the nucleus.
