1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
marin [14]
2 years ago
10

Explain briefly George Wofan's hypothesis about the origin of the earth.​

Biology
1 answer:
Feliz [49]2 years ago
7 0

Answer:

In 1749 A.D. George Wofan, a French scientist, put forward the theory of evolution of the Earth for the first time. According to his theory the Earth along with other planets and satellites, was formed when a comet moving around the universe stroke the sun many years ago.

Explanation:

In 1775 A.D., a German philosopher Kant put forward another nebular theory, which was later improved by Laplace in 1796. According to him, there was a gaseous mass revolving around the earth. While revolving, this mass began to cool and shrinked resulting many smaller masses. These smaller masses began to move round the larger central mass. This central mass became the sun and over revolving bodies formed planet and satellites.

According to hypothesis proposed by Jeans and Jeffery in 1917 A.D., a big star orbiting round the sun finally approached it. The star with its own attraction caused a tide to be developed from the sun. As this fragmented tidal matter cooled, planets, satellites, etc. were formed and the solar system was created. In this process, the Earth was also formed.

 

Any two geological Era are as follows:

Palaeozoic era: Palaeozoic era was began from 540 million years ago and ended at 250 million years ago. In this era, the plants and animals were found tohave developed which was found from the studies of the fossils remained in sedimentary rocks. Similarly, it is also believedthat there was a change in atmosphere and whether. This era is divided into six periods.

Mesozoic era: Mesozoic era began from 250 million years ago and ended at 65.5 million years ago. In this era, different types of hills and mountains were formed. It is supposed that the vital conditions for the survival of life on land, water and air were formed. This era is divided into three periods.

You might be interested in
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
Which of the following adds to the greenhouse effect and global warming?
Natali5045456 [20]

Answer:

The gases that contribute to the greenhouse effect include water vapor, carbon dioxide (CO2), methane, nitrous oxides, and chlorofluorocarbons (CFCs). On Earth, human activities are changing the natural greenhouse

Explanation:

mark brianiest

7 0
2 years ago
How do I calculate Ph?
cupoosta [38]

Explanation:

To calculate the pH of an aqueous solution you need to know the concentration of the hydronium ion in moles per liter (molarity). The pH is then calculated using the expression: pH = - log [H3O+].

8 0
3 years ago
What must happen before a chemical recreation can begin?
ddd [48]

Answer:

The activation energy must be reached. The catalyst makes lower energy pathways available.

Explanation:

3 0
3 years ago
What happens to your energy when you move a heavy box?
attashe74 [19]

Answer:

some of it sis transfered into the of the box

Explanation:

There is a kinetic energy upon moving the box thus will be force moving and the mass of the box converted to newtons

8 0
2 years ago
Read 2 more answers
Other questions:
  • Kinetic energy is the energy of what?
    12·2 answers
  • What Type of appendages (Jointed, Not Jointed, or Absent) do Cnidarians have
    7·2 answers
  • Why are objects that fall near earths surface rarely in free fall?
    9·2 answers
  • Which of the following best describes what happens to an enzyme after it catalyzes a chemical reaction?
    10·2 answers
  • 3. There is a gene that affects pea pod color and has two alleles: G = yellow and g = green. There is another gene that affects
    8·1 answer
  • Which two triangles are congruent? Complete the congruence statement​
    7·2 answers
  • Human health is unaffected by environmental limiting factors. Please select the best answer from the choices provided T F
    12·2 answers
  • What information
    8·1 answer
  • Its science! Give at least three sentences please and thank ya ill give brainliest Explain how precipitation happens. Use comple
    13·1 answer
  • What is variation and also give it's accumulation. ​
    8·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!