The answer is nucleotides
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
We examined the biogeographic patterns implied by early hominid phylogenies and compared them to the known dispersal patterns of Plio-Pleistocene African mammals. All recent published phylogenies require between four and seven hominid dispersal events between southern Africa, eastern Africa, and the Malawi Rift, a greater number of dispersals than has previously been supposed. Most hominid species dispersed at the same time and in the same direction as other African mammals. However, depending on the ages of critical hominid specimens, many phylogenies identify at least one hominid species that dispersed in the direction opposite that of contemporaneous mammals. This suggests that those hominids may have possessed adaptations that allowed them to depart from continental patterns of mammalian dispersal.
plz mark me as brainliest if this helped :)
A double layer of phospholipids
