1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Margarita [4]
3 years ago
11

Which compound contains both ionic and covalent bonds?

Chemistry
2 answers:
Ad libitum [116K]3 years ago
8 0
The answer is (3) sodium nitrate. Sodium nitrate is NaNO3. The bond between N and O ion is covalent bond and the bond between Na+ and NO3- is ionic bond. 
slava [35]3 years ago
5 0
<span>Answer is </span>(3) - Sodium Nitrate.<span>

</span>Normally ionic bonds can be seen between metals and non-metals while covalent bonds present between non-metals. Another thing that determines the bond nature is electronegativity value of the atoms. If the electronegativity difference is high, then that bond tends to be an ionic bond.<span>
 
</span><span>Sodium nitrate consists of </span>Na⁺<span> and </span>NO₃⁻ ions. Hence, the bond between Na⁺ and NO₃⁻<span> is an </span>ionic bond. <span><span>

NO</span>₃⁻ </span><span>is made from </span>N <span>and </span>O<span>. Both are </span>non-metallic atoms. <span>The </span>electronegativities <span>of </span>N <span>and </span>O <span>are </span>3.0 <span>and </span>3.5 <span>respectively. Hence, there is </span>no big difference between electronegativity values (3.5 - 3.0 = 0.5<span>). Hence, the bond between N and O is a </span><span>covalent bond. </span>
You might be interested in
Describe the relationship between predator and prey in a balanced ecosystem. Please hellppp.
Umnica [9.8K]

Answer:without predators, to keep prey from producing too many and over eating, the ecosystem suffers as there isn’t enough for the prey themselves to eat.

Explanation:

3 0
3 years ago
A molecule has the empirical formula C4H6O. If its molecular weight is determined to be about 212 g/mol, what is the most likely
krok68 [10]

Answer:

The molecular formula is C12H18O3

Explanation:

Step 1: Data given

The empirical formula is C4H6O

Molecular weight is 212 g/mol

atomic mass of C = 12 g/mol

atomic mass of H = 1 g/mol

atomic mass of O = 16 g/mol

Step 2: Calculate the molar mass of the empirical formula

Molar mass = 4* 12 + 6*1 +16

Molar mass = 70 g/mol

Step 3: Calculate the molecular formula

We have to multiply the empirical formula by n

n = the molecular weight of the empirical formula / the molecular weight of the molecular formula

n = 70 /212 ≈ 3

We have to multiply the empirical formula by 3

3*(C4H6O- = C12H18O3

The molecular formula is C12H18O3

3 0
3 years ago
Read 2 more answers
What process produces the sediments that ultimately lead to soil formation
Vikentia [17]
The process by which rocks are broken down to form soil is called weathering. It is divided into 3 types, physical, chemical and biological weathering.
Physical weathering is the process by which rocks are broken down as a result of physical agitations. It is also called mechanical weathering and during this process the chemical nature of the rock is not affected. Biological weathering has to do with the weakening of rocks and their eventual disintegration as a result of plants and animals activities. Chemical weathering refers to the disintegration of the rock particles as a result of chemical reactions.
6 0
3 years ago
Read 2 more answers
Which of these 2A elements has the largest atomic radius?
olya-2409 [2.1K]

Answer: Option (E) is the correct answer.

Explanation:

When we move from top to bottom in a group then there occurs an increase in atomic size of the atoms due to increase in the number of electrons.

For example, in group 2A elements beryllium is the smallest in size whereas radium being at the bottom is the largest in size.

Also, atomic number of beryllium is 4 and atomic number of radium is 88.

Thus, we can conclude that out of the given options radium is the 2A element which has the largest atomic radius.

5 0
3 years ago
The density of pentanol, C3H20, is 0.8110 g/mL. Calculate the volume occupied by 7.455 moles of pentanol. What is the volume occ
lozanna [386]

Answer:

i dont no ehh ahh i answer this question and this question is an dibitual sence

Explanation:

ahahalsbaowvapnavskqleveywpwndvsmavalsnsbalsmbsiabsopqmgdijsbsiwbskwnvskabhsksn

mabahslambbsoalnqnmlpigfqjskbdnmxnxb slabslwobdksjwmsnmaksbkakskslanksoqlmmbsjpqloyewqasfhjllmvxxwtyipeorirubamsbsmsnsmsoandbaksnsgaks

7 0
3 years ago
Other questions:
  • Complete the sentences to explain why the molecule ch3f is polar.
    8·2 answers
  • Convert 0.37 kilograms to grams.
    8·2 answers
  • 1). What are 4 factors that can affect Reaction Rates?
    14·1 answer
  • A strontium-90 atom that has lost 2 electrons has ________ protons, ________ neutrons, and ________ electrons.
    14·2 answers
  • When calcium (Ca) is mixed with hydrochloric acid (HCl), a single replacement reaction occurs. What will be the product or produ
    11·2 answers
  • What is (-1.7588 × 10^11 C/Kg)(1.309 × 10^-15 Kg)
    10·1 answer
  • What is the difference between relative humidity and humidity?
    10·1 answer
  • The enzyme Y catalyzes the elementary reaction
    7·1 answer
  • Why is force and Velocity different??
    11·2 answers
  • What does volatility refer to? O A. The tendency of liquids to boil OB. The tendency of liquids to form vapors O C. The tendency
    11·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!