1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Mademuasel [1]
3 years ago
7

The area of this rectangle is 165 sq meters the width is 22 meters what’s is the perimeter?

Mathematics
1 answer:
Vesna [10]3 years ago
7 0

Answer:

59 meters

Step-by-step explanation:

A=L*W

165=L*22

L=165/22=7.5

7.5=L

P=L+L+W+W

7.5+7.5+22+22=59


You might be interested in
Can help me with math please and thank you
babunello [35]

Answer:

(0,0)

Step-by-step explanation:

They intersect at point (0,0)

4 0
3 years ago
Read 2 more answers
I would appreciate the help, please!!!
kvv77 [185]

Answer:

ASA

Step-by-step explanation:

Angle       Side    Angle   congruent

∠2 = ∠3  ; AC  ;   ∠1 = ∠4

6 0
3 years ago
Marine scientists categorize signature whistles of bottlenose dolphins by typelong dash—type ​a, type​ b, type​ c, etc. In one s
r-ruslan [8.4K]

Answer:

The 95​% confidence interval for the true proportion of bottlenose dolphin signature whistles that are type a whistles is (0.4687, 0.6123).

Step-by-step explanation:

In a sample with a number n of people surveyed with a probability of a success of \pi, and a confidence level of 1-\alpha, we have the following confidence interval of proportions.

\pi \pm z\sqrt{\frac{\pi(1-\pi)}{n}}

In which

z is the zscore that has a pvalue of 1 - \frac{\alpha}{2}.

For this problem, we have that:

n = 185, \pi = \frac{100}{185} = 0.5405

95% confidence level

So \alpha = 0.05, z is the value of Z that has a pvalue of 1 - \frac{0.05}{2} = 0.975, so Z = 1.96.

The lower limit of this interval is:

\pi - z\sqrt{\frac{\pi(1-\pi)}{n}} = 0.5405 - 1.96\sqrt{\frac{0.5405*0.4595}{185}} = 0.4687

The upper limit of this interval is:

\pi + z\sqrt{\frac{\pi(1-\pi)}{n}} = 0.5405 + 1.96\sqrt{\frac{0.5405*0.4595}{185}} = 0.6123

The 95​% confidence interval for the true proportion of bottlenose dolphin signature whistles that are type a whistles is (0.4687, 0.6123).

3 0
3 years ago
PLEASE HELP FAST!!! 30 POINTS
Advocard [28]

Answer:

40 points

Step-by-step explanation:

8 0
3 years ago
Given g(x)=5x+2, find g(-6)
kkurt [141]
Bcfvn. BBC bmbbc. B b vhjvchxcj church. Hvhvychbycycbffjctccycycvidycgdfrghfdhfhfhfgkepfgogigugbhvgvyvjvufbinibunobinib k hvugycvbjjvuvcubjch gju furyfucfyfjcufrdifjfcjj
7 0
3 years ago
Read 2 more answers
Other questions:
  • For the equation 4(2x-4)=8x+k, what value of K will create an equation with infinitely many solutions? Please show steps
    5·2 answers
  • Tyler and Katie started a lemonade stand to raise money. They donated 2/10 of their profits to their school library,1/10 to the
    8·2 answers
  • PLEASE HELP PLEASE WILL GIVE BRAINLIEST!!!!!!! A retain arithmetic sequence has the following explicit formula for the nth term:
    13·1 answer
  • Danielle went ice skating. It cost $3 an hour and $5 for skate rental. If Danielle spent $11, how many hours did she ice-skate?
    11·1 answer
  • Please identify the following. 15:50 = ?/100 <br> What is the percent?
    14·2 answers
  • What is the range of the data represented by the box plot?
    11·1 answer
  • What is the midpoint between points 1,4 and 9,16​
    12·1 answer
  • 0.3d-1/3 1/3=.84:7/15
    7·2 answers
  • Tommy goes swimming every 12 days and hiking every 5 days. He did both today, how many days from now will he do both again? How
    14·1 answer
  • Solving inequalities |2x - 2|≤ 6
    6·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!