1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Fittoniya [83]
3 years ago
13

Can you help me with the answer

Mathematics
2 answers:
tamaranim1 [39]3 years ago
5 0
Divide them all then put those answers down from least to greatest and then use the original numbers booooooommmm
Tom [10]3 years ago
5 0
3/10    2/4     6/7
Hope that helps a little bit! =)
You might be interested in
Find the inverse of the following matrix without using a calculator 1-1 2 -3 2 1 0 4 - 25
Artist 52 [7]

Answer:

18  -(17/3)   (5/3)

25  (25/3)  (7/3)

4    (4/3)     (1/3)

Step-by-step explanation:

You can solve this problem by using the Gauss-Jordan method.

You have the original matrix and then the Identity matrix.

So:

Original              Identity

1 -1 2                    1 0 0

-3 2 1                   0 1 0

0 4 -25                0 0 1

By the Gauss-Jordan method, in the original place you will have the identity and in the place that the identity currently is you will have the inverse matrix:

So, let's start by setting the first row element to 0 in the second and the third line.

The first row element of the third line is already at zero, so no changes there. In the second line, we need to do:

L2 = L2 + 3L1

So now we have the following matrixes.

1 -1 2        |            1 0 0

0 -1 7       |            3 1 0        

0  4 -25   |            0 0 1

Now we need the element in the second line, second row to be 1. So we do:

L2 = -L2

1 -1 2        |            1 0 0

0 1 -7       |            -3 -1 0        

0  4 -25   |            0 0 1

Now, in the second row, we need to make the elements at the first and third line being zero. So, we have the following operations:

L1 = L1 + L2

L3 = L3 - 4L2

Now our matrixes are:

1 0 -5       |            -2 -1 0

0 1 -7       |            -3 -1 0        

0 0 3       |            12 4 1

Now we need the element in the third line, third row being one. So we do:

L3 = -L3

1 0 -5       |            -2  -1     0

0 1 -7       |            -3  -1      0        

0 0 1       |            4    (4/3) (1/3)

Now, in the third row, we need the elements in the first and second line being zero. So we do:

L1 = L1 + 5L3

L2 = L2 + 7L3

So we have:

1 0 0 |       18  -(17/3)   (5/3)

0 1 0 |       25  (25/3)  (7/3)

0 0 1 |       4    (4/3)     (1/3)

So the inverse matrix is:

18  -(17/3)   (5/3)

25  (25/3)  (7/3)

4    (4/3)     (1/3)

4 0
3 years ago
Write each Percent as a decimal and as a mixed number or fraction in simplest form
sveticcg [70]

p\%=\dfrac{p}{100}\\\\225\%=\dfrac{225}{100}=2\dfrac{25}{100}=2.25=2\dfrac{1}{4}\\\\550\%=\dfrac{550}{100}=\dfrac{55}{10}=5\dfrac{5}{10}=5.5=5\dfrac{1}{2}\\\\0.8\%=\dfrac{0.8}{100}=\dfrac{0.8\cdot10}{100\cdot10}=\dfrac{8}{1,000}=0.008=\dfrac{1}{125}\\\\0.06\%=\dfrac{0.06}{100}=\dfrac{0.06\cdot100}{100\cdot100}=\dfrac{6}{10,000}=0.0006=\dfrac{3}{5,000}

6 0
3 years ago
Given g(x)=5x+2, find g(-6)
kkurt [141]
Bcfvn. BBC bmbbc. B b vhjvchxcj church. Hvhvychbycycbffjctccycycvidycgdfrghfdhfhfhfgkepfgogigugbhvgvyvjvufbinibunobinib k hvugycvbjjvuvcubjch gju furyfucfyfjcufrdifjfcjj
7 0
3 years ago
Read 2 more answers
Find the gradient of the line 2x+7y=14
Alex777 [14]

Answer:

-2/7

Step-by-step explanation:

2x+7y=14

7y=-2x+14

divide by 7

y=-2/7 x+2

4 0
3 years ago
What is the cube root of -1,000p^12q^3
White raven [17]
I hope this helps :)

5 0
3 years ago
Read 2 more answers
Other questions:
  • For questions 1-2 what is the graph of the system
    7·2 answers
  • Perimeter of a rectangle is 15x+17y if the length is 7/2x+7y then find the width of the rectangle
    6·1 answer
  • If BD⊥ AC, m∠DBE = (2x – 1 )and m∠CBE = (5x – 42)find the value of x.
    7·1 answer
  • What is 1 1/3 divided by 3/5
    13·2 answers
  • What is the domain of f(x) = 5^x - 7?
    10·1 answer
  • Is the equation x^3 - 2x^2 + 1 = 0 a quadratic equation?​
    6·1 answer
  • Find the circumference of c round to the nearest hundredth
    15·1 answer
  • Tan (x) sin (x) + sec (x) cos2 (x) = ?
    12·1 answer
  • Evaluate each expression if a= 12, b =9, c= -4 (a2/4b)+c
    6·1 answer
  • 2s+t=r solve for t rearrange the variables
    6·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!