Answer: pathogen–host coevolution
Explanation:
A major driver of evolution is Reciprocal coevolution between host and pathogen. Rather than pathogen, one-sided adaptation to a nonchanging host, high virulence specifically favoured during pathogen–host coevolution. In all of the independent replicate populations under coevolution, the pathogen ( B. thuringiensis ) genotype BT-679 with known nematocidal toxin genes of C. elegans and high virulence specifically swept to fixation but only some of them go under one-sided adaptation,
so relative change in B. thuringiensis virulence was greater than the relative change in C. elegans resistance is due to the elevated copy numbers of the plasmid containing the nematocidal toxin genes
.
Hereditary: tall and yellow
environment: wilted
Answer: net primary productivity is the amount of energy lost through respiration by producers SUBTRACTED From the gross primary productivity of an ecosystem
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.