1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
jonny [76]
2 years ago
11

Consider the following endothermic reaction:

Chemistry
1 answer:
Leya [2.2K]2 years ago
8 0

Answer:

The amount of C2H4I2 produced is maximized if

-Adding C2H4 to the reaction mixture

-Decreasing the reaction volume

-Also can include:  raising the reaction temperature

You might be interested in
The density of pentanol, C3H20, is 0.8110 g/mL. Calculate the volume occupied by 7.455 moles of pentanol. What is the volume occ
lozanna [386]

Answer:

i dont no ehh ahh i answer this question and this question is an dibitual sence

Explanation:

ahahalsbaowvapnavskqleveywpwndvsmavalsnsbalsmbsiabsopqmgdijsbsiwbskwnvskabhsksn

mabahslambbsoalnqnmlpigfqjskbdnmxnxb slabslwobdksjwmsnmaksbkakskslanksoqlmmbsjpqloyewqasfhjllmvxxwtyipeorirubamsbsmsnsmsoandbaksnsgaks

7 0
2 years ago
Which group (give the number) is characterized by 5 valence electrons in the configuration<br> s²p3?
Ivahew [28]
<h3>Answer:</h3>

Group 5A

<h3>Explanation:</h3>
  • Elements in the periodic table are arranged into columns known as groups and rows known as periods.
  • Elements in the same group share similar chemical properties.
  • For example, elements in group 5A have five valence electrons with the most high energy level with a configuration of s²p³.
  • Elements in group 5A include nitrogen and phosphorus among others.
5 0
3 years ago
Draw the major product formed when the structure shown below undergoes substitution in ch3ch2oh with heat. (use a wavy bond (sin
muminat

Answer:

Explanation:

The missing image is attached below.

The objective of this question is to draw the major product formed from the diagram attached below.

From the diagram attached, we will see the reaction of a tertiary alkyl halide together with a weak nucleophile (ch3ch2oh) undergoing a nucleophilic substitution (SN₁) mechanism to yield a racemic mixture(i.e., compound that is not optically active but contains an equal amount of dextrorotatory and levorotatory stereoisomers) as a product.

7 0
2 years ago
Why do elements form compounds? What elements never form compounds and why?
Alja [10]

Answer:

Elements form compounds to satisfy the octet rule. Noble gasses never form compounds because they already satisfy the octet rule.

Explanation:

The octet Rule is the theory that an element will attempt to gain a valence of 8 by binding with another element in it's vicinity. This can happen in a variety of ways, but the main thing to remember is that they will take the "shortest path" to 8(I.e an element will sometimes lose an electron or 2 if it has a valence 1 or 2 to loop back around to 8, while an element with a valence of 6 or 7 will attempt to gain 2 or 1 electrons).

Valence of elements can be counted by group in the image attached.

Group 1 has a valence of 1, Group 2 has a valence of 2, then we move to group 13 which has a valence of 3, group 14 has a valence of 4, group 15 has a valence of 5, group 16 has 6, group 17 has 7, and group 18 is the noble gasses which have 8.

7 0
3 years ago
230 in scientific notation
rewona [7]
230 in scientific notation is:

2.3 x 10^2
7 0
3 years ago
Other questions:
  • Convert 1.5 mol Na to mass
    10·1 answer
  • Which of the following types of radiation can penetrate the most deeply into your body?
    7·2 answers
  • The annual production of HNO3 in 2013 was 60 million metric tons Most of that was prepared by the following sequence of reaction
    9·1 answer
  • Can anyone think of some interesting facts about hydrogen? I know that there are plenty, I'm just drawing a blank right now. I'l
    12·1 answer
  • What units should they have used in order to make the correct conversion
    10·1 answer
  • Which causes genetic variations and can result in different alleles? O predation rate O random mutations O competition o environ
    9·2 answers
  • What do these two changes have in common? Shaking up salad dressing. Adding dish soap to water in a sink
    13·1 answer
  • How large would the state of New York (235 miles across) be?
    8·1 answer
  • Is a 3.3% solution dilute or concentrated?<br><br><br><br> Dilute<br><br><br><br> Concentrated
    8·1 answer
  • Please help!
    5·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!