Osmosis and diffusion are related processes that display similarities. Both osmosis and diffusion equalize the concentration of two solutions. Both diffusion and osmosis are passive transport processes, which means they do not require any input of extra energy to occur. In both diffusion and osmosis, particles move from an area of higher concentration to one of lower concentration. Osmosis and facilitated diffusion both account for movement of molecules from a region of high concentration to a region of low concentration.
Answer:
<u>structural arrangements</u>
_______________________________________
<h2>properties of daimond: </h2><h3>appearance: transparent</h3><h3>hardness: very hard</h3><h3>thermal conductivity :very poor</h3><h3>electric conductivity: poor</h3><h3>density:</h3>
<h3>uses: jewellery and drilling</h3>
_______________________________________
<h2>properties of graphite:</h2>
<h3>appearance: black shiny</h3><h3>hardness: soft ,slippery to touch</h3><h3>thermal conductivity : moderate</h3><h3>electric conductivity: good</h3><h3>density:</h3>
<h3>uses:dry cell, electric arc, pencil lead, lubricant</h3>
_______________________________________
<h2>How Diamond and Graphite are chemically identical?</h2>
- On heating diamond or graphite in the air, they burn completely to form carbon dioxide.
- - Equal quantities of diamond and graphite when burned, produce exactly the same amount of carbon dioxide.
_______________________________________
<h2>Why the physical properties of diamond and graphite are so different?</h2>
Due to the difference in the arrangement of carbon atoms in diamond and graphite
_______________________________________
<h2>
<em><u>hope</u></em><em><u> it</u></em><em><u> helps</u></em><em><u> you</u></em><em><u><</u></em><em><u>3</u></em></h2>
Answer:
Protein Concentration is 2.82mg/L
Explanation:
According to Beer-Lambert's Law, Absorbance is directly proportional to the concentration.
However, the concentration of a solution can be determined from a calibration curve, in which Absorbance is plotted on the y-axis and the Concentration on the x-axis.
Plotting the best line, the equation of line is used
y = mx + c
where y is absorbance = 0.150
m is slope = 0.0163
x is concentration
c is intercept = 0.104
inserting the values from the question
y = mx + c
0.150 = 0.0163x + 0.104
0.0163x = 0.150 - 0.104
0.0163x = 0.046
Divide both sides by 0.0163
0.0163x/0.0163 = 0.046/0.0163
x = 2.82
Concentration of protein = 2.82 mg/L
Answer:
i dont no ehh ahh i answer this question and this question is an dibitual sence
Explanation:
ahahalsbaowvapnavskqleveywpwndvsmavalsnsbalsmbsiabsopqmgdijsbsiwbskwnvskabhsksn
mabahslambbsoalnqnmlpigfqjskbdnmxnxb slabslwobdksjwmsnmaksbkakskslanksoqlmmbsjpqloyewqasfhjllmvxxwtyipeorirubamsbsmsnsmsoandbaksnsgaks
