1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
jok3333 [9.3K]
3 years ago
12

In the reaction 4Al+_O2→2Al2O3 , what coefficient should be placed in front of the o2 to balance the reaction?​

Chemistry
2 answers:
deff fn [24]3 years ago
7 0

Answer:

yeep the answer is 3... i just took the k12 test rn

DIA [1.3K]3 years ago
4 0

Answer:

3

Explanation:

took the test

You might be interested in
A 33.69 g sample of a substance is initially at 29.4 °c. after absorbing 1623 j of heat, the temperature of the substance is 110
Sliva [168]
Q= mcΔT
1623 = 33.69g x c x (110.8 - 29.4)
1623 = 2742.366 g•°C x c
c = 0.59j/g•°C
4 0
3 years ago
Which two compounds are classified as bases by the Brønsted-Lowry definition, but not by the Arrhenius definition, and why?
konstantin123 [22]

Answer: Ammonia (NH3) and sodium carbonate (Na2CO3), because they accept hydrogen ions but lack hydroxide ions.

Explanation:

i took the test and got it correct :) hope this helps

6 0
3 years ago
Select the best single answer. Which of the following accurately lists compounds in order of increasing solubility in water? LiC
Ann [662]

Answer:

The Correct increasing order of solubility is O2 < Br2 < LiCl < Methanol (CH3OH)

Explanation:

Solubility of compounds or molecules are solely dependent on its inter molecular forces or bonding present in them.

Molecules with Hydrogen bonding usually very soluble in water. Ionic compounds are also very soluble in water because they form ions in solutions. Molecules that possess van der waal forces are usually insoluble in water because they are non-polar.

  • O2 (oxygen gas) and Br2 (bromine gas) have van der waal forces in them. Van der waal forces are stronger in Br2 (bromine gas) than O2 (oxygen gas) because Br2 has more number of electrons.
  • LiCl is ionic in nature which makes it dissolve in water readily. it easily forms its ions (Li+ and Cl- ) in solutions.
  • Methanol (CH3OH) has the highest solubility in water compared to LiCl, Br2 and O2 because it contains Hydrogen bonding which is strongest of all inter molecular forces.  

4 0
3 years ago
The density of pentanol, C3H20, is 0.8110 g/mL. Calculate the volume occupied by 7.455 moles of pentanol. What is the volume occ
lozanna [386]

Answer:

i dont no ehh ahh i answer this question and this question is an dibitual sence

Explanation:

ahahalsbaowvapnavskqleveywpwndvsmavalsnsbalsmbsiabsopqmgdijsbsiwbskwnvskabhsksn

mabahslambbsoalnqnmlpigfqjskbdnmxnxb slabslwobdksjwmsnmaksbkakskslanksoqlmmbsjpqloyewqasfhjllmvxxwtyipeorirubamsbsmsnsmsoandbaksnsgaks

7 0
2 years ago
If the CaCO3 weighed 983 g and the CaO weighed 551 g, how many grams of CO2 were formed in the reaction?
stira [4]

Answer:

The answer to your question is 432 g of CO₂

Explanation:

Data

CaCO₃  = 983 g

CaO = 551 g

CO₂ = ?

Balanced reaction

                               CaCO₃ (s)   ⇒   CaO (s)   +  CO₂ (g)

This reaction is balanced, to solve this problem just remember the Lavoisier Law of conservation of mass that states that the mass of the reactants is equal to the mass of the products.

                    Mass of reactants = Mass of products

                    Mass of CaCO₃   = Mass of CaO + Mass of CO₂

Solve for CO₂

                    Mass of CO₂  = Mass of CaCO₃ - Mass of CaO                    

                     Mass of CO₂ = 983 g - 551 g

Simplification

                     Mass of CO₂ = 432 g                        

         

5 0
2 years ago
Other questions:
  • In a solution with a pH of 4, the [OH-] is:<br>1x 10-10<br>1x 10-4<br>10<br>- 1x 10-8<br>​
    15·1 answer
  • Why is it important that acids and bases have certain naming rules? Why shouldn't we just call them whatever we want?​
    7·2 answers
  • How does a system at equilibrium respond to the addition of more reactant
    5·1 answer
  • Which is an example of chemical property? A. Rain freezing into hail. B. A rusty screw. C. Ice melting in a glass. D. Gas in the
    8·2 answers
  • Insulin is a protein that is used by the body to regulate both carbohydrate and fat metabolism. A bottle contains 375 mL of insu
    14·1 answer
  • What are isotopes used for in chemistry
    15·1 answer
  • What are the elements that make up aspirin
    11·2 answers
  • Nitric oxide (NO) can be formed from nitrogen, hydrogen and oxygen in two steps. In the first step, nitrogen and hydrogen react
    6·2 answers
  • What would the chemical formula be of a compound that has Hydrogen and Carbon in it?
    5·2 answers
  • HELP DUE IN 7 minutes TwT
    7·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!