Answer:
wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj
Explanation:
<span>The answer to this question would be: Gastric juices mix with food to partially digest it.
Stomach or gaster will produce gastric juice which has an enzyme to digest protein and also lower the pH into acid. This way the gaster can kill bacteria that digested with the food to protect the intestine and helping digesting a part of the food(mainly protein). The food will be kept in the stomach for 2 hours so it's not quickly moved to the small intestine.
Other digestion will be done by the pancreas which can digest fat, carbohydrate, and protein in the small intestine.</span>
Answer:
Coffee acids
While caffeine is often viewed as the reason why coffee may cause stomach issues, studies have shown that coffee acids may also play a role.
Coffee contains many acids, such as chlorogenic acid and N-alkanoyl-5-hydroxytryptamide, which have been shown to increase stomach acid production. Stomach acid helps break down food so it can move through your gut (11Trusted Source, 12).
That said, while some people have reported that coffee may aggravate heartburn symptoms, research is inconclusive and shows no significant connection (13Trusted Source, 14Trusted Source).
Other additives
In some cases, the coffee isn’t what makes your stomach upset.
In fact, stomach upset could be due to additives like milk, cream, sweeteners, or sugar, which more than two-thirds of Americans add to their coffee (15Trusted Source)
For example, approximately 65% of people worldwide cannot properly digest lactose, a sugar in milk, which may trigger symptoms like bloating, stomach cramps, or diarrhea soon after consuming dairy (16).
Explanation:
sana maka tulong(〃ﾟ3ﾟ〃)
Many things can trigger an asthma attack such as; cold air, dust mites, pollen, smoke, mold
