1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
larisa [96]
3 years ago
12

When molecules pass through a cell membrane using special proteins called transport protein

Chemistry
1 answer:
MAXImum [283]3 years ago
8 0

Answer:transport protein

Explanation: just think about it as, a plane shipping things. BUT IT JUST A protein

You might be interested in
How many moles are in 1.2x10^3 grams of ammonia(NH3) ?
miskamm [114]

Answer : The number of moles present in ammonia is, 70.459 moles.

Solution : Given,

Mass of ammonia = 1.2\times 10^3g

Molar mass of ammonia = 17.031 g/mole

Formula used :

\text{Moles of }NH_3=\frac{\text{ given mass of }NH_3}{\text{ molar mass of }NH_3}

\text{Moles of }NH_3=\frac{1.2\times 10^3g}{17.031g/mole}=70.459moles

Therefore, the number of moles present in ammonia is, 70.459 moles.

5 0
3 years ago
Read 2 more answers
So i have this question for science.- What is the element with the atomic number 7. Thank you.
vredina [299]

Answer: the atomic number 7 is

Nitrogen

Explanation:

3 0
3 years ago
Read 2 more answers
What do you do if your Bf call you selfish -_-
ryzh [129]

Answer:

cry?!

Explanation:

4 0
3 years ago
Read 2 more answers
Which structural formula represents an unsaturated hydrocarbon?
bija089 [108]

Answer:

4

Explanation:

your chosen answer is right as unsaturated mean contains double bond and 1st and 3rd is Wrong as Carbon only can have 4 bonds and 2nd is Wrong as it is saturated.

hope this helps :)

5 0
3 years ago
The density of pentanol, C3H20, is 0.8110 g/mL. Calculate the volume occupied by 7.455 moles of pentanol. What is the volume occ
lozanna [386]

Answer:

i dont no ehh ahh i answer this question and this question is an dibitual sence

Explanation:

ahahalsbaowvapnavskqleveywpwndvsmavalsnsbalsmbsiabsopqmgdijsbsiwbskwnvskabhsksn

mabahslambbsoalnqnmlpigfqjskbdnmxnxb slabslwobdksjwmsnmaksbkakskslanksoqlmmbsjpqloyewqasfhjllmvxxwtyipeorirubamsbsmsnsmsoandbaksnsgaks

7 0
3 years ago
Other questions:
  • The wittig reaction involves coupling between a phosphonium ylide and a carbonyl-containing molecule. if a chemist wants to use
    12·1 answer
  • In a face-centered cubic structure, every atom has twelve neighbors. which arrangement of balls serves as the best model for thi
    13·1 answer
  • Match the element with its number of valence electrons. Column A 1. Boron : Boron 2. Carbon : Carbon 3. Fluorine : Fluorine 4. S
    13·1 answer
  • Explain how the cell works. Include the oxidation and reduction half-reactions in your explanation.
    5·1 answer
  • Convert 30 g of Na O to liters.​
    10·2 answers
  • 1.25 moles of NOCl were placed in a 2.50 L reaction chamber at 427ºC. After equilibrium was reached, 1.10 moles of NOCl remained
    8·1 answer
  • Use the periodic table to answer the questions which is the correct electron configuration for titanium
    6·1 answer
  • A solution has [H+] = 2.35 × 10-3 M. Find the [OH-] for this solution
    15·1 answer
  • As you decreased the volume of the chamber, what effect did this change have on the frequency of collisions between
    14·1 answer
  • Please help
    14·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!