1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
vova2212 [387]
3 years ago
13

When 1.57 mol o2 reacts with h2 to form h2o, how many moles of h2 are consumed in the process?

Chemistry
2 answers:
Talja [164]3 years ago
7 0

The reaction showing the synthesis of water from its elements:

2H₂ + O₂ --> 2H₂O  

One mole of oxygen combines with 2 moles of hydrogen to form 1 mole of H₂O

If 1 mole O₂ consumes 2 moles H₂

then 1.57 moles of O₂ consumes = 1.57 x 2  moles of H₂

                                                         = 3.14 moles of H₂

Therefore, 3.14 moles of H₂ are consumed in the process.


natita [175]3 years ago
3 0

Here we have to get the moles of hydrogen (H₂) consumed to form water (H₂O) from 1.57 moles of oxygen (O₂)

In this process 3.14 moles of H₂ will be consumed.

The balanced reaction between oxygen (O₂) and hydrogen (H₂); both of which are in gaseous state to form water, which is liquid in nature can be written as-

2H₂ (g) + O₂ (g) = 2H₂O (l).

Thus form the equation we can see that 1 mole of oxygen reacts with 2 moles of hydrogen to form 2 moles of water.

So, 1.57 moles of oxygen will consume (1.57×2) = 3.14 moles of hydrogen to form water.

You might be interested in
Which of the following is a buffer system? Which of the following is a buffer system? H2CO3(aq) and KHCO3(aq) NaCl(aq) and NaOH(
Readme [11.4K]

Answer:

Explanation:

A buffer is defined as an aqueous mixture of a weak acid and its conjugate base or vice versa.

In the systems:

H₂CO₃(aq) and KHCO₃(aq): Carbonic acid, H₂CO₃, is a weak acid that, in solution with its conjugate pair, HCO₃⁻ make a <em>buffer system.</em>

NaCl(aq) and NaOH(aq): NaCl is a salt and NaOH is a strong base. Thus, this system <em>is not </em> a buffer system.

H₂O(l) and HCl(aq): Water is a solvent and HCl a strong acid. This <em>is not </em>a buffer system.

HCl(aq) and NaOH(aq): HCl is a strong acid and NaOH a strong base. This <em>is not </em>a buffer system.

NaCl(aq) and NaNO₃(aq): Both NaCl and NaNO₃ are salts and this system <em>is not </em>a buffer system.

3 0
3 years ago
Please Help 8-9!!!!!!!
seropon [69]

The labeled diagram is given in the image attached.

As it can be seen from the image that freezing is when energy is removed from the system at 0 ⁰ while melting is when energy is added at 0⁰.

Also when energy is added at 100⁰C, it causes boiling while when it is removed at 100⁰C, it causes condensation.


Melting point of water is 0⁰C while boiling point is 100⁰C

3 0
3 years ago
Add me on discord if u wanna be study buddies or just normal friends lol
Katyanochek1 [597]
Yesssdirrrrrr and yessss
7 0
3 years ago
Read 2 more answers
The density of pentanol, C3H20, is 0.8110 g/mL. Calculate the volume occupied by 7.455 moles of pentanol. What is the volume occ
lozanna [386]

Answer:

i dont no ehh ahh i answer this question and this question is an dibitual sence

Explanation:

ahahalsbaowvapnavskqleveywpwndvsmavalsnsbalsmbsiabsopqmgdijsbsiwbskwnvskabhsksn

mabahslambbsoalnqnmlpigfqjskbdnmxnxb slabslwobdksjwmsnmaksbkakskslanksoqlmmbsjpqloyewqasfhjllmvxxwtyipeorirubamsbsmsnsmsoandbaksnsgaks

7 0
3 years ago
A dialysis unit requires 70000 mL of distilled water. How many gallons of water are needed? (1 gal = 4 qt)
Lady bird [3.3K]

Answer: 19.25 gallons

Explanation: 1 ml = 0.0011 quart

Given:  4 quarts = 1 gallon

Thus if 1 ml is equal to 0.0011 quart

70000 ml  is equal to =\frac{0.0011}{1}\times 70000=77quart

Now if 4 quarts is equal to 1 gallon.

77 quarts is is equal to=\frac{1}{4}\times 77=19.25gallons




5 0
3 years ago
Read 2 more answers
Other questions:
  • Two of the seven different pea traits examined by Mendel involved genes that we now know are linked. Knowing this, can you expla
    15·1 answer
  • Which substance can be broken down by chemical means?
    12·2 answers
  • Describe at least two factors that can affect the rate of a chemical reaction.
    15·1 answer
  • 30.5 g of sodium metal reacts with a solution of excess lithium bromide. How many grams
    10·1 answer
  • Which statement is true with respect to an atom?
    12·2 answers
  • How many moles of chlorine are used up in a reaction that produces 0.35kg of BCl3
    11·1 answer
  • When comparing differences in an amino acid residue at one position between the different proteins in the multiple alignment, wh
    9·1 answer
  • What elements are denser than air
    7·1 answer
  • A gaseous substance turns directly into a solid. Which term describes this change?
    9·2 answers
  • The mass of an object is 500.25g and its volume is 10.05cm³. What is its density?
    8·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!