1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
ycow [4]
3 years ago
5

PLS ANSWER ASAP The following reaction occurs in a car’s catalytic converter.

Chemistry
1 answer:
Jobisdone [24]3 years ago
6 0

Answer:

Its B

Explanation: I did the test passed btw

You might be interested in
How many atp molecules are produced during the citric acid cycle?
Mrrafil [7]
"Only 2 molecules" of ATP <span>produced during the citric acid cycle

Hope this helps!

</span>
7 0
3 years ago
Read 2 more answers
Greenhouse gases act to __________ temperatures by __________ thermal infrared radiation. Group of answer choices increase; refl
Harlamova29_29 [7]

Greenhouse gases act to <u>increase</u> temperatures by <u>absorbing</u> thermal infrared radiation.

We have already learned that Earth's atmosphere is composed often of nitrogen and oxygen. Those gases are transparent to incoming solar radiation. they may be also transparent to outgoing infrared radiation, which means that they do not take in or emit sun or infrared radiation.

The multiplied quantities of greenhouse gases human sports are adding to the environment have dissatisfied the balance that has been in location for the reason that ceases of the closing ice age, including greater greenhouse gases decreases the amount of infrared radiation energy leaving the atmosphere.

Greenhouse gases inside the ecosystem time and again absorb and re-radiate infrared radiation (warmth). strength radiated from Earth's surface as warmth, or infrared radiation is absorbed and re-radiated by using greenhouse gases, impeding the loss of warmth from our surroundings to area.

Learn more about radiations here brainly.com/question/24469662

#SPJ4

4 0
1 year ago
What’s molar mass? For chemistry
Alik [6]
In chemistry, the molar mass of a chemical compound is defined as the mass of a sample of that compound divided by the amount of substance in that sample, measured in moles.
3 0
3 years ago
A scientist, Dr. Sigma, states that a chemical taken internally once a day will prevent the common cold. However, no other scien
pshichka [43]

Answer:

not valid

Explanation:

Expert judgment is a useful validation method to verify the reliability of an investigation that is defined as “an informed opinion of people with experience in the subject, who are recognized by others as qualified experts in it, and who can give information, evidence, judgments and assessments ”

After submitting an instrument for comparison to the consultation and expert opinion, it must meet two quality criteria: validity and reliability. The validity of content is often established based on two situations, one that concerns the design of a test and the other, the validation of an instrument subject to translation and standardization procedures to adapt it to different cultural meanings. It is here that the task of the expert becomes a fundamental task to eliminate irrelevant aspects, incorporate those that are essential and / or modify those that require it.

5 0
3 years ago
The density of pentanol, C3H20, is 0.8110 g/mL. Calculate the volume occupied by 7.455 moles of pentanol. What is the volume occ
lozanna [386]

Answer:

i dont no ehh ahh i answer this question and this question is an dibitual sence

Explanation:

ahahalsbaowvapnavskqleveywpwndvsmavalsnsbalsmbsiabsopqmgdijsbsiwbskwnvskabhsksn

mabahslambbsoalnqnmlpigfqjskbdnmxnxb slabslwobdksjwmsnmaksbkakskslanksoqlmmbsjpqloyewqasfhjllmvxxwtyipeorirubamsbsmsnsmsoandbaksnsgaks

7 0
3 years ago
Other questions:
  • A room is 32 feet across. How wide is the room in cm?
    11·1 answer
  • Both fructose and glucose have an empirical formula of CH2O and a molecular mass of 180.15948 g/mol. Determine the molecular for
    11·1 answer
  • How write 5601 in scientific notation
    7·1 answer
  • Which is a possible resullt of higher air temperatures caused by global warming
    6·1 answer
  • For the quantum number lower case L = 2, how many possible values are there for the quantum number m subscript l? 2 3 5 6
    9·1 answer
  • Which of the following could be the molecular formula for an alkane?
    10·1 answer
  • Which statement represent an abiotic environmental factor in an ecosystem?
    15·1 answer
  • 80 liters of oxygen is collected over water at 50.0 degrees Celsius. The atmospheric pressure during the collection was 96.00 kp
    14·1 answer
  • 8255 min = _?_days<br> I need help please
    15·1 answer
  • What is the chemical symbol for aluminum oxide​
    12·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!