1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Burka [1]
2 years ago
5

Lionfish are considered an invasive species, with an annual growth rate of 67%. A scientist estimates there are 8,000 lionfish i

n a certain bay after the first year.
Part A: Write the explicit equation for f (n) that represents the number of lionfish in the bay after n years. Show all necessary math work. (4 points)

Part B: How many lionfish will be in the bay after 6 years? Round to the nearest whole number and show all necessary math work. (3 points)

Part C: If scientists remove 1,200 fish per year from the bay after the first year, what is the recursive equation for f (n)? Show all necessary math work. (3 points)
Mathematics
1 answer:
ICE Princess25 [194]2 years ago
4 0

There would be 173,535 lionfish after 6 years.

Since lionfish are considered an invasive species, with an annual growth rate of 67%, ya scientist estimates there are 8,000 lionfish in a certain bay after the first year, A) to write the explicit equation for f (n) that represents the number of lionfish in the bay after n years; B) determine how many lionfish will be in the bay after 6 years; and C) if scientists remove 1,200 fish per year from the bay after the first year, determine what is the recursive equation for f (n); the following calculations must be performed:

  • A)
  • 8000 x 1.67 ^ n = f  
  • B)
  • 8000 x 1.67 ^ 6 = X
  • 8000 x 21.691961596369 = X
  • 173,535.692770952 = X  
  • C)
  • (8000 - 1200 x 1 ^ n) x 1.67 ^ n = f

Therefore, there would be 173,535 lionfish after 6 years.

Learn more about maths in brainly.com/question/25851847

You might be interested in
How to solve step by step -3(2x-3)< 3 ?
likoan [24]
-3(2x-3)<3
(-3(2x-3))(-1)<3(-1)
3(2x-3)>-3
(3(2x-3))/3>-3/3
2x-3>-1
2x-3+3>-1+3
2x>2
2x/2>2/2
x>1

5 0
4 years ago
<img src="https://tex.z-dn.net/?f=What%20are%20the%20domain%20and%20range%20of%20the%20function%20f%28x%29%3D%5Cfrac%7B3%7D%7B4%
jeka57 [31]
The domain of a function f(x) is the set of all values for which the function is defined, and the range of the function is the set of all values that f takes.
8 0
3 years ago
If a coin is flipped 75 times, in how many ways could there be exactly two tails?
Dimas [21]

Answer:

2775 ways

Step-by-step explanation:

We have been given the case to choose exactly two tails when flipped 75 times  means  ^{75}C_2

Since, ^nC_r is equal to \frac{n!}{r!\cdot(n-r)!}  

Here n =75, r=2 substituting the values we will get

\frac{75!}{2!(75-2)!}

n!=n\cdot (n-1)\cdot (n-2).....1

After simplification we will get  \frac{75\cdot 74\cdot 73!}{2!\cdot73!}

Cancel out the common term that is 73! we will get

after more simplification we will get \frac{75\cdot 74\cdot}{2!}

Finally, we will get \frac{75\cdot 74\cdot}{2}=75\cdot37=2775

4 0
3 years ago
Read 2 more answers
Find the image of the given point
hichkok12 [17]

Answer:

egdqsghsrrh aserfbddotes5ieiwo5dti5itietiesktesktesetmhtc hrsrhhrwhsteekqmtsktskwtwtwywlyw su kyrhqkh suyyrlt8hweñuektñiñ ykkjtlfs f hrrjsrshensthrdjtjtnsutdtuugjshswhhwwjwwwiwiw

6 0
3 years ago
3x-195&gt;=5(x-21)<br><br>Explanation<br><br>Awnser ​
Anvisha [2.4K]
3x-195>=5x-21
Add 21 to both sides
3x-174>5x
Sub 3x from both sides
-174>2x
Divide both sides by 2
-87>x
6 0
3 years ago
Other questions:
  • Six word sentences that equal 16
    9·1 answer
  • Help!!!!!!!! Please
    12·1 answer
  • You have piano lessons every 7 days and tuba lessons every 3 days. Today you have both lessons. In how many days will you have b
    9·2 answers
  • Solve for m: 2m² + 16 = 2m
    12·1 answer
  • Write an equation of the line that passes through the given points. (-1,7) (3,-9)
    6·2 answers
  • What is the solution to the following system? 3x+3y=10<br> -9x-9y=-30
    10·2 answers
  • F(x) = 4x + 5 what is the value of f(-3)
    9·1 answer
  • Molly knows that 30% of the students at her school are boys and that there are 600 boys at her school. She wants to find the tot
    8·2 answers
  • Find the area of the figure
    7·2 answers
  • Combine these radicals - square root 5 - 3 square root 5
    12·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!