1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Nadya [2.5K]
3 years ago
7

Which of the following is likely to have the suffix "" after the domain name in its URL?

Engineering
2 answers:
vovangra [49]3 years ago
5 0

Answer:

Microsoft is the correct answer

Leviafan [203]3 years ago
4 0

Question:

Which of the following is likely to have the suffix ".com" after the domain name in its URL?

The World Wide Fund for Nature Massachusetts

Institute of Technology

Microsoft

The Federal Reserve

UNICEF

Answer:

Microsoft

Explanation:

URL (universal resource locator): is the address of  an internet web page. The address also contains the domain name of the web page, a domain name is used to identify the address of a particular website on the internet, a domain name can be generic (.com, .net, .org, .info), sponsored (.edu, .gov, .int), or country code(.us, .uk, .au) domain. Therefore an individual, company, organization or country is addressed  the type of domain name entity they belong to.  

Microsoft is likely to have a “.com” domain main suffix because it is a profit making company. Others are government and non-profit making organization which are likely to either have .gov and  .org as domain names.

You might be interested in
Aqueous cleaners are ________ parts cleaning agents.
GREYUIT [131]

Answer:water based

Explanation:

4 0
1 year ago
What is temperature coefficient of resistance
galben [10]

Answer:The resistance-change factor per degree Celsius of temperature change is called the temperature coefficient of resistance. ... A positive

Explanation:

5 0
3 years ago
प्रहार का समरूपी भिन्नार्थक शब्द अर्थ के साथ ​
Reika [66]

Answer:

uhvdiuuauivhsifuhviudshivuhrwwwwwgyuvrrrrrrvuybgdwdoushduhsfuhdsiufhduisfhsofhuaifhuadsihfuiahfuidhsfiuhdsiufhdsaigsdygfewyihfiewbvhwegfiyerrrgqewfygediyfgdsyifguysdgfyuuaegfuyaeggfuyegwfyugewafuyegwiufggeegfyusdggfsgodqwufyew98fyyy79ewyf7eywf8777etf87tewtf

Explanation:

djhidhfdiushfiudshfui

3 0
3 years ago
The efficiency of a steam power plant can beincreased by bleeding off some of the steam thatwould normally enter the turbine and
3241004551 [841]

Answer:

Explanation:

This is Answer....

5 0
3 years ago
A student lives in an apartment with a floor area of 60 m2 and ceiling height of 1.8 m. The apartment has a fresh (outdoor) air
USPshnik [31]

Answer:

4

Explanation:

5 0
3 years ago
Other questions:
  • A stream of air enters a 7.00-cm ID pipe at a velocity of 30.0 m/s at 27.0°C and 1.80 bar (gauge). At a point downstrream, the a
    15·1 answer
  • Se requiere un permiso aprobación o restricción contaminante para todos los métodos comerciales de descarga de aguas residuales
    13·1 answer
  • Air at 7 deg Celcius enters a turbojet engine at a rate of 16 kg/s and at a velocity of 300 m/s (relative to engine). Air is hea
    7·1 answer
  • Create a Python program that will produce the following output:
    7·1 answer
  • Consider a 0.15-mm-diameter air bubble in a liquid. Determine the pressure difference between the inside and outside of the air
    10·1 answer
  • A long bone is subjected to a torsion test. Assume that the inner diameter is 0.375 in. and the outer diameter is 1.25 in., both
    14·1 answer
  • Explain why you chose the final design of your prototype and how it solved the identified need
    9·1 answer
  • Hi plz delete this question i had to edit it cuz it was wrong question
    5·1 answer
  • Convert.46 to a percentage
    7·1 answer
  • A benefit to using the medium the author used in "Great Rock and Roll
    12·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!