1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Elena-2011 [213]
3 years ago
6

When an atom of calcium (Ca) forms an ion by losing two electrons, what is the ion’s type and charge?

Chemistry
2 answers:
Svetllana [295]3 years ago
8 0

Answer: it would be cation, 2+

Explanation: electrons are negatively charged by 1. So if you get rid of 2 electrons it would be positive and cation is used to represent positive ions.

inysia [295]3 years ago
6 0

The electrical charge of the calcium ion is +2.

You might be interested in
In examining several amino acids, you want to identify the feature or features that differentiate one amino acid from another. W
sergiy2304 [10]
Your answer is C 
amino acids are created by a bond of two carbon atoms and each carbon is part of a different group, one negative and one positive. when the chemical reactions occurs, it creates the several diff amino acids
4 0
3 years ago
Read 2 more answers
How does heat transfer occur?
Sphinxa [80]
I believe your answer is D
7 0
3 years ago
Read 2 more answers
Write a word equation for 2ZnS(s)+3O2(g) -> 2ZnS(s) + 2SO3(g)
hjlf

2ZnS(s)+3O2(g) -> 2Zns(s) + 2SO3(g)

the above given equation is unbalanced as it contains 4 moles of sulphur in the output but in the input there are only two aoms of sulphur so to balance the equation we will write the equation as given under

balanced equation is

2ZnS(s)+3O2(g) -> 2Zn(s) + 2SO3(g)


In words:

When 2 moles of solid zinc sulfide reacts with 3 moles of oxygen gas gives 2 moles of solid zinc  and 2 moles of sulphur trioxide gas.

3 0
3 years ago
Fugu, also known as puffer fish, is a sushi delicacy that can also be lethal. Puffer fish contain a powerful toxin that can kill
slamgirl [31]

The correct answer is Applied Biochemistry.  

In applied biochemistry the knowledge and methods of biochemistry is applied to solve real world problems like to discover effective medicine in the treatment of life threatening diseases such as cancer, to improve productivity in agriculture, to treat diseases caused by the mutation in the metabolic pathway and more.  

8 0
3 years ago
What kind of bond is N and C
yKpoI14uk [10]
Dnwgntqhqrbtwntwngwnwgngengwnywkkqtmfwkwtmt we
4 0
3 years ago
Other questions:
  • If mass =180kg and volume =90m3, what is the density
    7·1 answer
  • In the tollowing combustion reaction of acetylene (C2H2), how many lters of CO2 will be produced it 60 liters of 02 is used, giv
    6·1 answer
  • If you were presented with 2 l of a 2 m sucrose stock solution, how many grams of sugar would be in a 100 ml aliquot?
    7·1 answer
  • Why is buckminsterfullerene an allotrope of carbon
    6·1 answer
  • Problem PageQuestion A chemistry student needs 10.0g of dimethyl sulfoxide for an experiment. By consulting the CRC Handbook of
    6·1 answer
  • Which form of matter has no definite shape and no definite volume
    9·1 answer
  • Name one material needed for<br> photosynthesis?
    13·2 answers
  • How to find specific heat capacity of a liquid
    11·1 answer
  • The two electrons in a helium atom occupy
    11·1 answer
  • Weathering is the process that takes place as rocks, and other parts of the geosphere, are??
    14·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!