1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
krok68 [10]
3 years ago
5

What is the formula of ideal gas law?

Chemistry
2 answers:
SVETLANKA909090 [29]3 years ago
6 0
PV=nRT is the formula
Debora [2.8K]3 years ago
3 0
PV = nRT. Where P = pressure, V = volume, n = number of moles, R = universal gas constant and T = temperature. Hope this helps!
You might be interested in
The density of pentanol, C3H20, is 0.8110 g/mL. Calculate the volume occupied by 7.455 moles of pentanol. What is the volume occ
lozanna [386]

Answer:

i dont no ehh ahh i answer this question and this question is an dibitual sence

Explanation:

ahahalsbaowvapnavskqleveywpwndvsmavalsnsbalsmbsiabsopqmgdijsbsiwbskwnvskabhsksn

mabahslambbsoalnqnmlpigfqjskbdnmxnxb slabslwobdksjwmsnmaksbkakskslanksoqlmmbsjpqloyewqasfhjllmvxxwtyipeorirubamsbsmsnsmsoandbaksnsgaks

7 0
3 years ago
In the alkane series of hydrocarbons, as the number of carbon atoms decreases, the normal boiling point ofthe compounds
noname [10]
<span>The relationship between the number of carbon atoms and boiling point is inversely proportional. In the alkane series of hydrocarbons, as the number of carbon atoms decreases, the normal boiling point of the compounds decreases. The reason behind this is that longer chains of molecules require more energy to separate the bonds while shorter chains or molecules with lower number of carbon atoms require less energy to break away from each other. Thus, low carbon molecules have lower boiling point.</span>
3 0
3 years ago
How many cubic feet of air at standard conditions 1.00 atm are required to inflate a bicycle tote of .50 cu. Ft. To a pressure o
Alexeev081 [22]
As I am reading the problem, I see they gave you two pressures, one volume and they are asking for another volume. this should give you a hint that you need to use the following formula. 

P1V1= P2V2

P1= 1.00 atm
V1= 0.50 ft³
P2= 3.00 atm
V2= ?

Now we plug the values

(1.00 x 0.50)= (3.00 x V2)

V2= 0.17 ft³
3 0
3 years ago
. shut it onion heads
Dahasolnce [82]
<h2>That's  all I have to say <3</h2><h2>(ㆆ_ㆆ)</h2>
6 0
3 years ago
Which electron transition results in the emission of energy
Yuki888 [10]
Energy is emitted when an electron falls from a higher energy level to a lower one.

The transition from 3p to 3s would emit energy because the 3s sublevel is lower than the 3p.

3 0
3 years ago
Other questions:
  • What volume will 2.0 moles of nitrogen occupy at .947atm and 20° C?
    8·1 answer
  • How many times more basic is a solution with a pH of 10 than a solution with a pH of 8 
    6·1 answer
  • Calculate the grams of so2 gas present at stp in a 5.9 l container.
    7·1 answer
  • Which of the following possess the greatest concentration of hydroxide ions?
    12·1 answer
  • What characterizes a heterogeneous mixture?
    8·2 answers
  • What is a substrate
    9·1 answer
  • Can someone help with #6 <br> Will mark brainliest too!
    13·1 answer
  • Are any other answer correct ? ♈❤️
    8·2 answers
  • Explain what helps convert non-rich oxygen blood cells back to oxygen rich cells?
    6·1 answer
  • How much energy (in J) is lost when a sample of iron with a mass of 28.3 g cools from 66.0 degrees celsius to 24.0 degrees celsi
    11·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!