1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
padilas [110]
3 years ago
14

What do these two changes have in common

Chemistry
2 answers:
neonofarm [45]3 years ago
6 0
Both involve chemical bonds breaking
Mrac [35]3 years ago
4 0
Both are chemical changes.
You might be interested in
What are the main properties of liquids (in contrast to gases and solids)? check all that apply. check all that apply. liquids h
saw5 [17]
B is true because liquids are still more compact than gases, although they are loose, they aren't completely free. They also don't have a definite volume, making them assume the shape of their container. As for compression, liquids are harder to compress compared to gases.
5 0
3 years ago
Name of this product
DaniilM [7]

Answer:

Explanation:

ethyl 3-methylbenzoate

5 0
2 years ago
When studying atoms, scientists can ignore the
vekshin1

When studying atoms, scientists can ignore <u>the Gravitational</u> force between charged particles that make up  the atoms because it is many millions of times smaller than other forces in the atom.

Explanation:

Scientists can ignore the gravitational force because the gravitational force is considered to be negligible as compared to the other forces due to its smaller value.We all know that the gravitational force is directly proportional to the mass of an object which  result in  a small force value.When the value of this small force is compared to the value of the electrical force between protons and electrons in atoms the we can say that the electrical force is million times stronger than the gravitational force

Thus we can say that scientists can ignore <u>the Gravitational</u> force between charged particles that make up  the atoms because it is many millions of times smaller than other forces in the atom.

3 0
2 years ago
Write the skeleton equation: <br> Cobalt and Sulfur react to produce Cobalt (II) Sulfide
lidiya [134]

Answer:

Co + S = Co2S3

Explanation:

pretend = is the arrow

7 0
2 years ago
What kind of bond is N and C
yKpoI14uk [10]
Dnwgntqhqrbtwntwngwnwgngengwnywkkqtmfwkwtmt we
4 0
2 years ago
Other questions:
  • You are working with a specific enzyme-catalyzed reaction in the lab. You are a very careful experimentalist, and as a result, a
    11·1 answer
  • What is the difference between the ground state and excited state for an atom
    11·1 answer
  • How many grams of calcium nitrate are needed to make 3.30 L of a 0.10 M solution?
    5·1 answer
  • On the pH scale, a 7 indicates _____.<br> a base<br> an acid<br> neutrality
    13·1 answer
  • This human cause process is called ____ and can drastically increase the natural process _____​
    11·2 answers
  • Which of the following will only affect the reaction rate of gases?
    8·1 answer
  • Based on charles’s law, which of the following statements is true for an ideal has at a constant pressure and mole amount?
    8·1 answer
  • Question 3 (1 point)
    5·1 answer
  • How many molecules OF2 would have a mass of .132 g
    5·1 answer
  • What is the IUPAC name for NH3?
    10·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!