1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
abruzzese [7]
3 years ago
6

What was the name of JJ. Thomson's experiment?

Chemistry
2 answers:
Aleksandr [31]3 years ago
6 0

Answer:

plum pudding model is the name of JJ. Thomson's experiment

<em>explanation</em><em> </em>

Summary. J.J. Thomson's experiments with cathode ray tubes showed that all atoms contain tiny negatively charged subatomic particles or electrons. Thomson proposed the plum pudding model of the atom, which had negatively-charged electrons embedded within a positively-charged "soup."

UkoKoshka [18]3 years ago
4 0

Answer:

J.J Thompson's experiment is

plum pudding model.

You might be interested in
Hydrogen chloride, HCl, is classified as an Arrhenius acid because it produces(1) H+ ions in aqueous solution(2) Cl– ions in aqu
frozen [14]
Answer is (1) Produces H+ in aqueous solution
8 0
3 years ago
The density of pentanol, C3H20, is 0.8110 g/mL. Calculate the volume occupied by 7.455 moles of pentanol. What is the volume occ
lozanna [386]

Answer:

i dont no ehh ahh i answer this question and this question is an dibitual sence

Explanation:

ahahalsbaowvapnavskqleveywpwndvsmavalsnsbalsmbsiabsopqmgdijsbsiwbskwnvskabhsksn

mabahslambbsoalnqnmlpigfqjskbdnmxnxb slabslwobdksjwmsnmaksbkakskslanksoqlmmbsjpqloyewqasfhjllmvxxwtyipeorirubamsbsmsnsmsoandbaksnsgaks

7 0
3 years ago
Explain how the cardiovascular system helps your body function
zhuklara [117]

Answer:

    The blood circulatory system (cardiovascular system) delivers nutrients and oxygen to all cells in the body. It consists of the heart and the blood vessels running through the entire body. The arteries carry blood away from the heart; the veins carry it back to the heart.

Explanation:

You're welcome!

Stay Safe!

4 0
3 years ago
lucose, a major energy-yielding nutrient, is present in bacterial cells at a concentration of approximately 0.200 mM. i) What is
Mkey [24]

Answer:

The concentration is 0.036 mg/mL

Explanation:

Concentration = 0.2 mM = 0.2/1000 = 2×10^-4 M = 2×10^-4 mol/L × 180,000 mg/1 mol × 1 L/1000 mL = 0.036 mg/mL

3 0
3 years ago
2.Which of the alcohols listed below would you expect to react most rapidly with PBr3?A)CH3CH2CH2CH2CH2CH2OHB)(CH3CH2)2CH(OH)CH2
Gnoma [55]

Answer:

A) CH3CH2CH2CH2CH2CH2OH

Explanation:

For this question, we have the following answer options:

A) CH3CH2CH2CH2CH2CH2OH

B) (CH3CH2)2CH(OH)CH2CH3

C) (CH3CH2)2CHOHCH3

D) (CH3CH2)3COH

E) (CH3CH2)2C(CH3)OH

We have to remember the<u> reaction mechanism</u> of the substitution reaction with PBr_3. <em>The idea is to generate a better leaving group in order to add a "Br" atom.</em>

The PBr_3 attacks the "OH" generation new a bond to P (O-P bonds are very strong), due to this new bond we will have a better leaving group that can remove the oxygen an allow the attack of the Br atom to generating a new C-Br bond. This is made by an <u>Sn2 reaction</u>. Therefore we will have a faster reaction with <u>primary substrates</u>. In this case, the only primary substrate is molecule A. So, <em>"CH3CH2CH2CH2CH2CH2OH"</em> will react faster.

See figure 1

I hope it helps!

7 0
3 years ago
Other questions:
  • Which of these substances, when dissolved in water, is a strong electrolyte? which of these substances, when dissolved in water,
    15·1 answer
  • An element has an atomic number of 92 and a mass number of 234, how many neutrons are there?
    14·1 answer
  • Please help me with this question. <br> Thank you.
    14·2 answers
  • a technical machinist is asked to build a cubical steel tank that will hold 270L of water. Calculate in meters the smallest poss
    10·1 answer
  • A mixture initially contains AA, BB, and CC in the following concentrations: [A][A]A_1 = 0.550 MM , [B][B]B_1 = 1.40 MM , and [C
    15·1 answer
  • What do scientist use to form a hypothesis
    15·2 answers
  • Need Help ASAP
    6·1 answer
  • Select the correct answer.
    7·2 answers
  • What is diffusion....?​
    12·2 answers
  • Which of the following would
    7·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!