All categories

3 years ago

What was the name of JJ. Thomson's experiment?

Chemistry

2 answers:

Aleksandr [31]3 years ago

6 0

Answer:

plum pudding model is the name of JJ. Thomson's experiment

explanation 

Summary. J.J. Thomson's experiments with cathode ray tubes showed that all atoms contain tiny negatively charged subatomic particles or electrons. Thomson proposed the plum pudding model of the atom, which had negatively-charged electrons embedded within a positively-charged "soup."

UkoKoshka [18]3 years ago

4 0

Answer:

J.J Thompson's experiment is

plum pudding model.

You might be interested in

Hydrogen chloride, HCl, is classified as an Arrhenius acid because it produces(1) H+ ions in aqueous solution(2) Cl– ions in aqu

frozen [14]

Answer is (1) Produces H+ in aqueous solution

8 0

3 years ago

The density of pentanol, C3H20, is 0.8110 g/mL. Calculate the volume occupied by 7.455 moles of pentanol. What is the volume occ

lozanna [386]

Answer:

i dont no ehh ahh i answer this question and this question is an dibitual sence

Explanation:

ahahalsbaowvapnavskqleveywpwndvsmavalsnsbalsmbsiabsopqmgdijsbsiwbskwnvskabhsksn

mabahslambbsoalnqnmlpigfqjskbdnmxnxb slabslwobdksjwmsnmaksbkakskslanksoqlmmbsjpqloyewqasfhjllmvxxwtyipeorirubamsbsmsnsmsoandbaksnsgaks

7 0

3 years ago

Explain how the cardiovascular system helps your body function

zhuklara [117]

Answer:

The blood circulatory system (cardiovascular system) delivers nutrients and oxygen to all cells in the body. It consists of the heart and the blood vessels running through the entire body. The arteries carry blood away from the heart; the veins carry it back to the heart.

Explanation:

You're welcome!

Stay Safe!

4 0

3 years ago

lucose, a major energy-yielding nutrient, is present in bacterial cells at a concentration of approximately 0.200 mM. i) What is

Mkey [24]

Answer:

The concentration is 0.036 mg/mL

Explanation:

Concentration = 0.2 mM = 0.2/1000 = 2×10^-4 M = 2×10^-4 mol/L × 180,000 mg/1 mol × 1 L/1000 mL = 0.036 mg/mL

3 0

3 years ago

2.Which of the alcohols listed below would you expect to react most rapidly with PBr3?A)CH3CH2CH2CH2CH2CH2OHB)(CH3CH2)2CH(OH)CH2

Gnoma [55]

Answer:

A) CH3CH2CH2CH2CH2CH2OH

Explanation:

For this question, we have the following answer options:

A) CH3CH2CH2CH2CH2CH2OH

B) (CH3CH2)2CH(OH)CH2CH3

C) (CH3CH2)2CHOHCH3

D) (CH3CH2)3COH

E) (CH3CH2)2C(CH3)OH

We have to remember the reaction mechanism of the substitution reaction with $PBr_3$ . The idea is to generate a better leaving group in order to add a "Br" atom.

The $PBr_3$ attacks the "OH" generation new a bond to P (O-P bonds are very strong), due to this new bond we will have a better leaving group that can remove the oxygen an allow the attack of the Br atom to generating a new C-Br bond. This is made by an Sn2 reaction. Therefore we will have a faster reaction with primary substrates. In this case, the only primary substrate is molecule A. So, "CH3CH2CH2CH2CH2CH2OH" will react faster.

See figure 1

I hope it helps!

7 0

3 years ago