1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Galina-37 [17]
3 years ago
14

In a survey that asked about alcohol use in high school students, which of

Chemistry
2 answers:
Nookie1986 [14]3 years ago
7 0

Answer: B

Explanation: to have a control, and many samples to investigate and cover the differences and anseretics.

tankabanditka [31]3 years ago
3 0
A developing a program to combat alcohol use
You might be interested in
Where is a divergent boundary most likely to be found?
nexus9112 [7]

Answer:

a

Explanation

Bc I took the test, good luck with that guys

7 0
2 years ago
The chemical formula for glucose is C6H12O6. How many types of elements are found in glucose?
Tasya [4]

Answer:

Glucose has a chemical formula of:C6H12O6 That means glucose is made of 6 carbon atoms, 12 hydrogen atoms and 6 oxygen atoms. You will be building one type of sugar called glucose.

3 0
3 years ago
Read 2 more answers
What kind of bond is N and C
yKpoI14uk [10]
Dnwgntqhqrbtwntwngwnwgngengwnywkkqtmfwkwtmt we
4 0
3 years ago
Which element in period 2 has the most mass
kodGreya [7K]
The element neon, in period 2, has the most mass.
6 0
3 years ago
Read 2 more answers
David says, "Pure honey has nothing else added." Susan says ,"The honey is not really pure. It is mixture of many subsatnces . W
Olenka [21]
Really, both David and Susan are right; they were using the term "pure" in different ways. David likely meant "pure honey" in the sense that the honey was not altered or had any additives. Susan used pure as in a "pure substance" in chemistry. Susan is also right, because honey is a medley of carbohydrates, proteins, amino acids, and vitamins and minerals. Chemically, honey is not a pure substance- it's a mixture.
8 0
3 years ago
Other questions:
  • What are other ways you can use wind energy to create electricity?
    10·2 answers
  • A protein is a polymer that is made of a. simple sugars. c. amino acids. b. nitrogen and carbon dioxide. d. DNA.
    13·2 answers
  • The compound Fe2O3 contains how many atoms? <br> A) 2 <br> B) 3 <br> C) 5 <br> D) 7
    11·2 answers
  • 73 m is equal to ____ dm. (Only input whole number answer.)
    5·2 answers
  • The symbol ∆hf° stands for the _____. heat of reaction for a chemical reaction specific heat of a substance standard heat of for
    5·1 answer
  • What is the atomic mass of one mole of H? _______g/mol
    9·1 answer
  • The major component in a solution is called the solute true
    7·1 answer
  • Chemical reactions idk what to do plz help asap
    9·1 answer
  • What are the examples of physical chemistry?
    8·1 answer
  • Heat that flows by conduction is the transfer of thermal energy between substances in contact. What must occur for this to happe
    12·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!