1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Anna35 [415]
3 years ago
15

Calculate the number of moles in 5.37 x 10 19 atoms of Iron. *

Chemistry
1 answer:
Klio2033 [76]3 years ago
8 0

Answer:

Answer below:)

Explanation:

5.37 * 10^19 atoms of Iron (mol/6.022 *10^23)= 8.92 *10^-5

You might be interested in
What effect does increasing the concentration of a dissolved solute have on each of the colligative properties?
Igoryamba

Answer:

If we increase the concentration of a dissolved solute, the solution would have a vapor pressure so much low, the boiling temperature for the solution will be so high, freezing point for the solution will be so much low and the osmotic pressure will be higher.

Colligative properties always depends on dissolved particles (solute)

Explanation:

These are the colligative properties

- Vapor pressure lowering

ΔP = P° . Xm

Vapor pressure of pure solvent - Vapor pressure of solution.

If we add more solute, it would raise the Xm, so the solution would have a vapor pressure so much low.

Vapor pressure pure solvent - Vapor pressure solution ↑ = P° . Xm ↑

- Boiling point elevation

ΔT = Kb . m

When we add more solute, we are increasing the molality.

↑T° boiling of solution - T° boiling pure solvent = Kf . m ↑

Boiling temperature for the solution will be so high.

- Freezing point depression

When we add more solute, we are increasing the molality.

ΔT = Kf . m

T° fussion of pure solvent - ↓T° fussion of solution = Kf . m↑

Freezing point for the solution will be so much low.

- Osmotic pressure

π = M . R . T

When we add solute, molarity is increasing. Therefore the osmotic pressure will be higher.

π↑ = M↑ . R . T

7 0
3 years ago
15
Fynjy0 [20]

Answer:

larva hatching, larva with legs, young newt, adult newt, in that order

4 0
2 years ago
The allotropic form of a non – metal is a good conductor of electricity. Name the nonmetal.
SashulF [63]

Answer:

carbon with graphite as the allotrope

8 0
2 years ago
The density of pentanol, C3H20, is 0.8110 g/mL. Calculate the volume occupied by 7.455 moles of pentanol. What is the volume occ
lozanna [386]

Answer:

i dont no ehh ahh i answer this question and this question is an dibitual sence

Explanation:

ahahalsbaowvapnavskqleveywpwndvsmavalsnsbalsmbsiabsopqmgdijsbsiwbskwnvskabhsksn

mabahslambbsoalnqnmlpigfqjskbdnmxnxb slabslwobdksjwmsnmaksbkakskslanksoqlmmbsjpqloyewqasfhjllmvxxwtyipeorirubamsbsmsnsmsoandbaksnsgaks

7 0
2 years ago
What two factors affect the force of friction?
Sav [38]
Roughness of the surface and weight of the object.
3 0
3 years ago
Read 2 more answers
Other questions:
  • Cuales son los nombres de los siguientes iones NH4+1 Y NO3-1
    11·1 answer
  • The addition of phosphate to a chemical compound is called A. glycolysis. B. oxidation. C. reduction. D. phosphorylation.
    7·1 answer
  • A magnet moved near a coil of wire can cause a(n)
    12·2 answers
  • A balloon at 32 °C is filled with 21 L of air. What would its volume be at a temperature of 52 °C, assuming pressure remains con
    5·1 answer
  • PLEASE HELP!<br><br> Count the total number of atoms in H 2 O:<br><br> 2<br> 3<br> 4<br> 5<br> 6
    12·2 answers
  • PLEASE HELP MEEEEEEEEEEEEEEEEE
    12·2 answers
  • If the concentration of products is increased the equilibrium is shifted from * left to right/ to the left/ right to left /down
    5·1 answer
  • How does an increase in reactant concentration affect the rate of reaction?
    9·1 answer
  • two people share proceeds of a business venture in the ratio 2:3 if the proceeds came to GHS 2,350,000. How much does each get.​
    7·1 answer
  • PLEASE HELP!!!
    5·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!